PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00422.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 284aa    MW: 31491.4 Da    PI: 9.6248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00422.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.3e-16213255547
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                              ++++r++kNRe+A rsR+RK+a+++eLe kv  LeaeN++L+ 
  Rsa1.0_00422.1_g00011.1 213 RKQKRMIKNRESAARSRARKQAYTQELEIKVSRLEAENERLRR 255
                              689**************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.9E-14206256No hitNo description
SMARTSM003387.6E-13209282IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.369211256IPR004827Basic-leucine zipper domain
CDDcd147075.40E-21213267No hitNo description
SuperFamilySSF579591.31E-10213258No hitNo description
PfamPF001701.9E-12213256IPR004827Basic-leucine zipper domain
PROSITE patternPS000360216231IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDSEREPKSQ SLNRQGSLYS LTLDEVQTHL AGSGKALGSM NLDELLKSVC SVEANQQQQQ  60
QQEDLSLSRQ GSLTLPRDLS KKTVEEVWKD IQHNNTNGSN AQERRDNNKQ ATLGDMTLED  120
LLLKAGVVTE TVTGGGGGLG ENNIPQAAGP WVQYHQLPSM MPQGQSFMPY PPVGDMQGAM  180
VSQSSLLMGG DTQTTPGRKR VASGEVVEKT VERKQKRMIK NRESAARSRA RKQAYTQELE  240
IKVSRLEAEN ERLRRQKEVE KILPSAPPPD PKRQQLRRTS SAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139071.11e-148PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-138AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A078CJ021e-145A0A078CJ02_BRANA; BnaA04g02780D protein
STRINGBra007274.1-P1e-144(Brassica rapa)
STRINGBra007276.1-P1e-144(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-132ABA-responsive element binding protein 3